DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and cdx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_989209.1 Gene:cdx2 / 394817 XenbaseID:XB-GENE-483306 Length:252 Species:Xenopus tropicalis


Alignment Length:297 Identity:102/297 - (34%)
Similarity:114/297 - (38%) Gaps:109/297 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PGAPQLNETNSSIGVG---GA-GGGGGVGGATDGGP-----GSAP---PNHQQHIAEGLPSP--- 181
            |.|||..:..|..|:|   || ..|...|..|..||     |..|   |.| .||.   |||   
 Frog    28 PAAPQYPDYGSYHGMGLDHGAPSSGSSAGWITPYGPPRDEWGVHPTYSPGH-THIN---PSPVGN 88

  Fly   182 --------PITVSGSEI-----SSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNN 233
                    |..|.|...     :.|....|..|...|..||                        
 Frog    89 MAFSPDYSPAQVQGQPCVGVLPAGPPPQLSPGSEDGHRRHH------------------------ 129

  Fly   234 NNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVY 298
                               ::|::||...|                   ....||||||||||||
 Frog   130 -------------------YEWLRKPVSQA-------------------STGSKTRTKDKYRVVY 156

  Fly   299 TDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGV 363
            ||.||||||||:..|||||||||:|||..|.|||||||||||||||||||..||         .:
 Frog   157 TDQQRLELEKEFHYSRYITIRRKAELAANLGLSERQVKIWFQNRRAKERKITKK---------RI 212

  Fly   364 QHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNI 400
            |.....|........||      |:.|.|.|.|..|:
 Frog   213 QQTQTGQNGPDTLSPEP------SITHHMIPHATSNV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
cdx2NP_989209.1 Caudal_act 13..135 CDD:368087 33/153 (22%)
Homeobox 153..206 CDD:365835 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7188
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4705
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm47998
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.