DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Noto

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001007473.1 Gene:Noto / 384452 MGIID:3053002 Length:240 Species:Mus musculus


Alignment Length:102 Identity:34/102 - (33%)
Similarity:49/102 - (48%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 DLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRA 344
            ||.|...:..|| :.|..:...|..||||.:.....:..:.:::||..|.|:|.||:|||||||.
Mouse   139 DLRDHGTERHTK-RVRTTFNLQQLQELEKVFAKQHNLVGKERAQLAARLHLTENQVRIWFQNRRV 202

  Fly   345 KERKQNK-------------KGSDPNV------MGVG 362
            |.:||.|             ..||.|:      :|:|
Mouse   203 KYQKQQKLKLPSSSVMEEPSSSSDGNIQSEDAELGIG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 21/54 (39%)
NotoNP_001007473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Homeodomain 150..206 CDD:459649 22/56 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..240 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.