DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and vax1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_919391.2 Gene:vax1 / 373870 ZFINID:ZDB-GENE-030904-9 Length:317 Species:Danio rerio


Alignment Length:145 Identity:47/145 - (32%)
Similarity:77/145 - (53%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 LDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKE 346
            ||...:|||......:|    |||:|.:.|  :|:..|.::|||:.|:|||.|||:||||||.|:
Zfish    89 LDRPKRTRTSFTAEQLY----RLEMEFQRC--QYVVGRERTELARQLNLSETQVKVWFQNRRTKQ 147

  Fly   347 RKQNKKGSD-PNVMGVGVQHADYSQLLDAKAKLE----PGLHLSHSLAHSMNPMAAMNIPAMRLH 406
            :|...|.|: .:|:..........:||:....|.    ||| |.|..:.|:.  :|:..|::.:.
Zfish   148 KKDQGKDSELRSVVSETAATCSVLRLLEQGRLLTPPGLPGL-LPHCGSSSLG--SALRGPSLGIT 209

  Fly   407 PHLAAHSHSLAAVAA 421
            .:..:.|.|.::..:
Zfish   210 ANGGSSSSSSSSAGS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
vax1NP_919391.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Homeobox 95..148 CDD:278475 28/58 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..248 3/22 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.