DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and vax2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_919390.1 Gene:vax2 / 373869 ZFINID:ZDB-GENE-030904-8 Length:307 Species:Danio rerio


Alignment Length:212 Identity:62/212 - (29%)
Similarity:87/212 - (41%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 NNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSS---PNLEDLSDLL---------- 282
            |:..:|:...:..|.|.|:....:  :.|...:...|..|:|   .:.||..|.|          
Zfish    17 NHCGSNSLCRDRGRESKSRTEVGN--RSPVQSSTDTPGTSASTPTSSSEDGHDKLLGVDPDYCRR 79

  Fly   283 ----DASG-----------------KTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQ 326
                ||.|                 :|||......:|    |||||.:.|  :|:..|.::|||:
Zfish    80 ILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLY----RLELEFQRC--QYVVGRERTELAR 138

  Fly   327 TLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHS 391
            .|:|||.|||:||||||.|::|...|.:|..........|..:.|    ..||.|..||.. |..
Zfish   139 QLNLSETQVKVWFQNRRTKQKKDQTKDTDKRSSSTSESLATCNIL----RLLEQGRLLSVP-APP 198

  Fly   392 MNPMAAMNIPAMRLHPH 408
            .||:.|        |||
Zfish   199 PNPLLA--------HPH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 26/51 (51%)
vax2NP_919390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 12/54 (22%)
Homeobox 106..159 CDD:278475 29/58 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..254 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.