DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Cdx1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_006254878.3 Gene:Cdx1 / 364883 RGDID:621233 Length:273 Species:Rattus norvegicus


Alignment Length:225 Identity:92/225 - (40%)
Similarity:107/225 - (47%) Gaps:59/225 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GVGGAT--DGGPGSAPPNHQQ-----HIAEGLPSPPITVSG---------SEISSPGAPTSASSP 202
            |:|..|  ..||..|||.:..     |: |..|:||.|.:.         :....||....|:||
  Rat    24 GLGPPTYAPPGPAPAPPQYPDFAGYTHV-EPAPAPPPTWAAPFPAPKDDWAAAYGPGPAVPAASP 87

  Fly   203 HHHLAH----HLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKP------PYFDWMK 257
             ..||.    ..|.|             |:.........:.|.....:||.|      || :||:
  Rat    88 -APLAFGPPPDFSPV-------------PAPPGPGPGILAQSLGGPGAPSSPGVQRRTPY-EWMR 137

  Fly   258 KPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKS 322
            :....|..                 ..||||||||||||||||.||||||||:..||||||||||
  Rat   138 RNVAAAGG-----------------GGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKS 185

  Fly   323 ELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            |||..|.|:|||||||||||||||||.|||
  Rat   186 ELAANLGLTERQVKIWFQNRRAKERKVNKK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
Cdx1XP_006254878.3 Caudal_act 13..138 CDD:398418 32/129 (25%)
Homeobox 158..211 CDD:395001 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7001
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44943
orthoMCL 1 0.900 - - OOG6_107786
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.