DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and NOTO

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001127934.1 Gene:NOTO / 344022 HGNCID:31839 Length:251 Species:Homo sapiens


Alignment Length:235 Identity:55/235 - (23%)
Similarity:79/235 - (33%) Gaps:90/235 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 SPPITVSGSEISSP-----GAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSV 239
            |||...|||.:..|     .||.|.:.|                      |:|.......:..||
Human     9 SPPPAPSGSRVRPPRSGRSPAPRSPTGP----------------------NTPRAPGRFESPFSV 51

  Fly   240 -SNNNRTSPSKP------------PYF------------------DWMKKPAYPA---QPQP--- 267
             :...|..|..|            |.|                  .|:  |||.:   .|.|   
Human    52 EAILARPDPCAPAASQPSGSACVHPAFWTAASLCATGGLPWACPTSWL--PAYLSVGFYPVPGPR 114

  Fly   268 ---------------------DLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYC 311
                                 .|.:.|:.....||.|..   |.:.:.|.::...|..||||.:.
Human   115 VAPVCGLLGFGVTGLELAHCSGLWAFPDWAPTEDLQDTE---RQQKRVRTMFNLEQLEELEKVFA 176

  Fly   312 TSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK 351
            ....:..:::::||..|.|:|.||::||||||.|.:||.|
Human   177 KQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVKYQKQQK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
NOTONP_001127934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 13/59 (22%)
Homeobox 160..211 CDD:278475 19/50 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..251
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.