Sequence 1: | NP_001260641.1 | Gene: | cad / 35341 | FlyBaseID: | FBgn0000251 | Length: | 445 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001127934.1 | Gene: | NOTO / 344022 | HGNCID: | 31839 | Length: | 251 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 55/235 - (23%) |
---|---|---|---|
Similarity: | 79/235 - (33%) | Gaps: | 90/235 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 SPPITVSGSEISSP-----GAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSV 239
Fly 240 -SNNNRTSPSKP------------PYF------------------DWMKKPAYPA---QPQP--- 267
Fly 268 ---------------------DLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYC 311
Fly 312 TSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK 351 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cad | NP_001260641.1 | Homeobox | 295..347 | CDD:278475 | 20/51 (39%) |
NOTO | NP_001127934.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..47 | 13/59 (22%) | |
Homeobox | 160..211 | CDD:278475 | 19/50 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 224..251 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |