DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and HOXA6

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_076919.1 Gene:HOXA6 / 3203 HGNCID:5107 Length:233 Species:Homo sapiens


Alignment Length:57 Identity:34/57 - (59%)
Similarity:44/57 - (77%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 RVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK 351
            |..||.:|.||||||:..:||:|.||:.|:|..|.|:|||:||||||||.|.:|:||
Human   159 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 31/52 (60%)
HOXA6NP_076919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..127
Antp-type hexapeptide 136..141
Homeodomain 156..212 CDD:459649 31/52 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..233 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.