DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and dlx6a

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571398.1 Gene:dlx6a / 30586 ZFINID:ZDB-GENE-980526-448 Length:247 Species:Danio rerio


Alignment Length:195 Identity:52/195 - (26%)
Similarity:80/195 - (41%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SGSEISSPGAPTS-------ASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNN 243
            |.|:.|||....|       .|..|||..|..|..:.:|:.|.:...|..:|             
Zfish    28 SHSQQSSPSMAASHYPLHCLHSGSHHHHQHDSSPYSGSNSYNRSLPYSYVSH------------- 79

  Fly   244 RTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDA----------------SGKTRTKD 292
               |...||.     |:|.:          |.......|||                :||.:...
Zfish    80 ---PHHSPYL-----PSYHS----------NASGTQTRLDATEQQKTTVIENGEIRFNGKGKKIR 126

  Fly   293 KYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPN 357
            |.|.:|:..|...|...:..::|:.:..::|||.:|.|::.||||||||:|:|.:|..|:|.:|:
Zfish   127 KPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGGNPH 191

  Fly   358  357
            Zfish   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
dlx6aNP_571398.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..66 12/37 (32%)
Homeobox 128..181 CDD:278475 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.