DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and dlx3b

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571397.2 Gene:dlx3b / 30585 ZFINID:ZDB-GENE-980526-280 Length:269 Species:Danio rerio


Alignment Length:267 Identity:62/267 - (23%)
Similarity:103/267 - (38%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LPSPPITVSGS------EISSPGAP-TSASSPHHHLAHHLSAVANNNNNNNNNNNSP-------S 228
            :|.....:|||      ...||..| :||:...::.:||            ....||       |
Zfish    10 IPGISTDLSGSMSCHPTSKDSPTLPESSATDMGYYSSHH------------EYYQSPPYPQQMNS 62

  Fly   229 THNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDK 293
            .|..|.:....:.....:.::.||..:.:...|....|....|:...|..:::...:||.:...|
Zfish    63 YHQFNLSGMGATPGAYPTKTEYPYNTYRQYGHYNRDLQTPPQSAVKEEPETEVRMVNGKPKKIRK 127

  Fly   294 YRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGS---- 354
            .|.:|:.:|...|::.:..::|:.:..::|||..|.|::.||||||||||:|.:|..|.|.    
Zfish   128 PRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLE 192

  Fly   355 -DPNVM-----------GVGVQHADYSQLLDAKAKLEP------------------GLHLSHSLA 389
             .||..           .|...:|..||:...:....|                  |.||.|.:.
Zfish   193 HSPNASDSMACNSPPSPAVWDNNAHSSQVNRGQIPQPPLSSTPPYMEDYSNHWYQQGSHLQHPVH 257

  Fly   390 HSMNPMA 396
            |...|.:
Zfish   258 HPGPPQS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 21/51 (41%)
dlx3bNP_571397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 9/30 (30%)
DLL_N 28..104 CDD:289198 16/87 (18%)
Homeobox 128..181 CDD:278475 21/52 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..242 7/50 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.