Sequence 1: | NP_001260641.1 | Gene: | cad / 35341 | FlyBaseID: | FBgn0000251 | Length: | 445 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571397.2 | Gene: | dlx3b / 30585 | ZFINID: | ZDB-GENE-980526-280 | Length: | 269 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 62/267 - (23%) |
---|---|---|---|
Similarity: | 103/267 - (38%) | Gaps: | 60/267 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 LPSPPITVSGS------EISSPGAP-TSASSPHHHLAHHLSAVANNNNNNNNNNNSP-------S 228
Fly 229 THNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDK 293
Fly 294 YRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGS---- 354
Fly 355 -DPNVM-----------GVGVQHADYSQLLDAKAKLEP------------------GLHLSHSLA 389
Fly 390 HSMNPMA 396 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cad | NP_001260641.1 | Homeobox | 295..347 | CDD:278475 | 21/51 (41%) |
dlx3b | NP_571397.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..41 | 9/30 (30%) | |
DLL_N | 28..104 | CDD:289198 | 16/87 (18%) | ||
Homeobox | 128..181 | CDD:278475 | 21/52 (40%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 191..242 | 7/50 (14%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 250..269 | 5/15 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0850 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |