DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and dlx4b

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571393.1 Gene:dlx4b / 30581 ZFINID:ZDB-GENE-990415-50 Length:254 Species:Danio rerio


Alignment Length:261 Identity:64/261 - (24%)
Similarity:100/261 - (38%) Gaps:69/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNN 219
            |.|...||       |.||.|....|.|........:.|| |.||::|..::.:           
Zfish    45 VHGLHSGG-------HLQHDAPYPSSAPHYSRPLGYAYPG-PVSAAAPGAYMPY----------- 90

  Fly   220 NNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDA 284
            ..||::....|....:.|.                  :|||.             :|:....|:.
Zfish    91 QPNNHSGALAHTRAEDTNH------------------EKPAV-------------IENGEIRLNG 124

  Fly   285 SGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQ 349
            .||...|.  |.:|:..|...|.:.:..::|:.:..:::||..|.|::.||||||||:|:|.:|.
Zfish   125 KGKKIRKP--RTIYSSVQLQALHQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKI 187

  Fly   350 NKKGSDPNVMGVGVQHADYSQLL--DAKAKLEPGLH--LSHSLAHS---MNPMAAMNIPAMRLHP 407
            .|.||.          ....:||  .:.:...|||.  ...|:|:.   |:|.:.||.......|
Zfish   188 MKHGSS----------GPEGELLHTSSSSPCSPGLSQLWEVSMANKVPPMHPSSYMNNYGHWYPP 242

  Fly   408 H 408
            |
Zfish   243 H 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 19/51 (37%)
dlx4bNP_571393.1 Homeobox 132..185 CDD:278475 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.