DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and dlx2a

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571386.2 Gene:dlx2a / 30574 ZFINID:ZDB-GENE-980526-212 Length:274 Species:Danio rerio


Alignment Length:291 Identity:74/291 - (25%)
Similarity:120/291 - (41%) Gaps:60/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 HQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSP-----ST 229
            |..|.::..|:.|::            |:..|.::            ||||.....||     |.
Zfish    26 HSLHKSQESPTLPVS------------TATDSSYY------------NNNNQQCAGSPYGQISSY 66

  Fly   230 HNNNNNNNSVSNNNRT-----SPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTR 289
            ...||:.|||..|.::     ..:..||      ..|.:...|..:.:...|...::...:||.:
Zfish    67 QYQNNSMNSVQYNTKSYELGFGNAFGPY------GTYGSCSSPTPADAEKEESEPEIRMVNGKPK 125

  Fly   290 TKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGS 354
            ...|.|.:|:.||...|::.:..::|:.:..::|||.:|.|::.||||||||||:|.:|..|.|.
Zfish   126 KVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLWKSGE 190

  Fly   355 DPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHS-----MNPMAAMNIPAMRLHPHLAAHS- 413
            .|     ..||...|   ::.....|.|..:...|||     :|...:.:.|.....|....:. 
Zfish   191 IP-----PEQHVASS---ESPPHPSPPLAAAWDFAHSQRMNTVNSGLSQSSPPNTTTPSFLTNYP 247

  Fly   414 -HSLAAVAAHSHQLQQQHSAQMSAAAAVGTL 443
             :|....|||. |....|:..:||    ||:
Zfish   248 WYSSTNSAAHL-QPPLHHNTTVSA----GTI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
dlx2aNP_571386.2 DLL_N 32..107 CDD:289198 21/104 (20%)
Homeobox 130..183 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.