DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and dlx4a

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571375.1 Gene:dlx4a / 30561 ZFINID:ZDB-GENE-980526-73 Length:250 Species:Danio rerio


Alignment Length:270 Identity:66/270 - (24%)
Similarity:104/270 - (38%) Gaps:70/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 NHQQHIAEGLPSPPITVSG---------SEISSPGAPTSASSP---HHHLAHHLSAVANNNNNNN 221
            :|||| :.|:......|.|         ....|||| .|.|.|   |:..|||            
Zfish    29 SHQQH-SPGVSHAHYPVHGLHQGAHSQYDAAFSPGA-ASYSRPLAYHYSTAHH------------ 79

  Fly   222 NNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASG 286
                .|..:....:|::|                    .|......|.....::|  |..:..:|
Zfish    80 ----HPGAYLPYQHNSAV--------------------GYSRVEDADSEKQSSIE--SGEIRLNG 118

  Fly   287 KTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK 351
            |.:...|.|.:|:..|...|.:.:..::|:.:..:::||..|.|::.||||||||:|:|.:|..|
Zfish   119 KGKKIRKPRTIYSSLQLQALNQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMK 183

  Fly   352 KGSD-PNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHS 415
            .||. |.  |..:|.|..|     .|...||          |.|:..:::|:.....|...:.:|
Zfish   184 HGSSGPE--GEHLQAASAS-----GAPCSPG----------MPPLWDVSMPSKGAPIHSGGYMNS 231

  Fly   416 LAAVAAHSHQ 425
            .....:..||
Zfish   232 FGHWYSGHHQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 19/51 (37%)
dlx4aNP_571375.1 COG5576 98..206 CDD:227863 35/116 (30%)
Homeobox 126..179 CDD:278475 19/52 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..202 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.