DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and emx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571355.2 Gene:emx2 / 30537 ZFINID:ZDB-GENE-990415-54 Length:247 Species:Danio rerio


Alignment Length:254 Identity:66/254 - (25%)
Similarity:97/254 - (38%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ASSSSASSGSSSSGGAPGAPQLNETNSSIGVGGAGGGGGV-GGATDGGPGSAPPNHQQHIAEGLP 179
            |:.|.|:|...:       |.||..:|| |.|.....|.| ..|....|.||.|.|      .:|
Zfish    34 AALSYANSSQMN-------PFLNGFHSS-GRGVYSNPGLVFAEAVSHPPNSAVPVH------SVP 84

  Fly   180 SPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNR 244
             ||..::...:|      |:.|||...|              :....|||               
Zfish    85 -PPHALAAHPLS------SSHSPHPLFA--------------SQQRDPST--------------- 113

  Fly   245 TSPSKPPYFDWM-KKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEK 308
                   ::.|: .:..|.........:||....|.:.|     .|...:.|..::..|.|.||.
Zfish   114 -------FYPWLIHRYRYLGHRFQGNETSPESFLLHNAL-----ARKPKRIRTAFSPSQLLRLEH 166

  Fly   309 EYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQ--NKKGSDPNVMGVGVQH 365
            .:..:.|:....:.:||.:|||:|.|||:||||||.|.::|  .::|||......|..|
Zfish   167 AFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFKRQKLEEEGSDSQQKKKGTHH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
emx2NP_571355.2 Homeobox 153..205 CDD:278475 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.