DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and emx3

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571354.1 Gene:emx3 / 30536 ZFINID:ZDB-GENE-990415-53 Length:233 Species:Danio rerio


Alignment Length:200 Identity:55/200 - (27%)
Similarity:83/200 - (41%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNN 243
            |||    .||...:.|....:|||....                  ..||||   :.|:.:|..:
Zfish    43 PSP----FGSCFQNSGRTLYSSSPEMMF------------------TDPSTH---STNSGLSLRH 82

  Fly   244 RTSPSKP----------PYFDWMKKPAYPAQP-QPDLSSSPNLEDLSDLLDASGKTRTKDKYRVV 297
            ...|::|          .::.|:.:..|.... |.|.||..||     ||......:.| :.|..
Zfish    83 LQIPTQPFFSPHQRDTLNFYPWVLRNRYLGHRFQGDDSSPENL-----LLHGPFSRKPK-RIRTA 141

  Fly   298 YTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQ--NKKGSDPNVMG 360
            ::..|.|.||:.:..:.|:....:.:||..|.|:|.|||:||||||.|.::|  .::..||....
Zfish   142 FSPSQLLRLERAFEKNHYVVGAERKQLANGLCLTETQVKVWFQNRRTKHKRQKLEEESPDPQQKR 206

  Fly   361 VGVQH 365
            .|.||
Zfish   207 KGSQH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 21/51 (41%)
emx3NP_571354.1 Homeobox 139..191 CDD:278475 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.