DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Dlx4

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:222 Identity:52/222 - (23%)
Similarity:91/222 - (40%) Gaps:59/222 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PGSAPPNHQQHIAEGLPSPPITVSGSEIS------SPGAPTSA----SSPHHHLAHHLSAVANNN 217
            ||..|.|        :..|.:..:.|.::      |||...|.    |..:.||..:        
  Rat     9 PGLGPSN--------VVFPDLAPASSVVAAYQLGLSPGTAASPDLSFSQTYGHLLSY-------- 57

  Fly   218 NNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPD-----LSSSPNLED 277
                 :...|:|..::..:   |.....:||:|    :.:...:|.:.:.:     ||..|:...
  Rat    58 -----SYPGPATPGDSYLS---SQQQSAAPSRP----FHQPTEHPQELEAESEKLALSLEPSQPS 110

  Fly   278 LSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNR 342
            |         ||...|.|.:|:..|...|.:.:..::|:.:..:::||..|.|::.||||||||:
  Rat   111 L---------TRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNK 166

  Fly   343 RAKERKQNKKGSDPNVMGVGVQHADYS 369
            |:|.:|..|:.|       |....|:|
  Rat   167 RSKYKKLLKQSS-------GELEEDFS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 19/51 (37%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.