DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and en2a

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_571119.2 Gene:en2a / 30243 ZFINID:ZDB-GENE-980526-167 Length:265 Species:Danio rerio


Alignment Length:220 Identity:62/220 - (28%)
Similarity:95/220 - (43%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 APPNHQQHIAEGLPSPPITVS-GSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPST 229
            |..||.       |:.|.|.. ||.:.:..|.|:          |.|:........:.....|..
Zfish    70 ARENHN-------PTGPSTGQVGSTVPAEEASTT----------HTSSGGKEAEIESEEPLKPRG 117

  Fly   230 HN-----NNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTR 289
            .|     .:.:::|.||:|..:.....:..|:....|..:|    ||.|.          |.|.:
Zfish   118 ENVDQCLGSESDSSQSNSNGQTGQGMLWPAWVYCTRYSDRP----SSGPR----------SRKPK 168

  Fly   290 TK-----DKY-RVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERK 348
            .|     ||. |..:|..|...|:.|:.|:||:|.:|:..|||.|.|:|.|:||||||:|||.:|
Zfish   169 KKAASKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIWFQNKRAKIKK 233

  Fly   349 QN--KKGSDPNVMGVGV-QHADYSQ 370
            .:  |.|...::|..|: .|:..|:
Zfish   234 ASGVKNGLAIHLMAQGLYNHSTTSK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 27/55 (49%)
en2aNP_571119.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..142 18/88 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..180 9/38 (24%)
Homeodomain 177..233 CDD:459649 27/55 (49%)
Engrail_1_C_sig 234..264 CDD:431338 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.