DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Cdx4

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001100412.1 Gene:Cdx4 / 302400 RGDID:1561529 Length:288 Species:Rattus norvegicus


Alignment Length:359 Identity:110/359 - (30%)
Similarity:136/359 - (37%) Gaps:145/359 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYNTLPYTQKHSAANLAYASAAGQPW---NWT--PNYHHTPPNHQFLGDVDSSHAAHHAAAAHQM 64
            |..||......|.|.:..:..:|.|.   |:|  |.|.|      ::|....|:...|       
  Rat    14 YPGTLRNPGGGSTAGVGTSGGSGSPLPASNFTAAPVYPH------YMGYPHMSNMDPH------- 65

  Fly    65 YYNSHHMFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGSSSSG 129
                        ..|.|.|.||.|...:::                         |...|.||:.
  Rat    66 ------------GPSLGAWSSPYSPPREDW-------------------------STYPGPSSTM 93

  Fly   130 GAPGAPQLNETNSSIGVGG-----AGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSE 189
            |.  .|..:.|:||...|.     .|..||.|||::||                 |.|...|.|.
  Rat    94 GT--VPMNDMTSSSPAFGSPDYSTLGPTGGAGGASNGG-----------------SLPDAASESL 139

  Fly   190 IS-SPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYF 253
            :| ..|....|:||                                      :.:|.||     :
  Rat   140 VSIDSGTSGGATSP--------------------------------------SRSRHSP-----Y 161

  Fly   254 DWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITI 318
            .||:|                      .:..:||||||:||||||||.||||||||:..:|||||
  Rat   162 AWMRK----------------------TVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITI 204

  Fly   319 RRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            |||||||..|.|||||||||||||||||||..||
  Rat   205 RRKSELAVNLGLSERQVKIWFQNRRAKERKMIKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
Cdx4NP_001100412.1 Caudal_act 13..166 CDD:398418 53/263 (20%)
Homeobox 181..234 CDD:395001 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7001
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4386
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm44943
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24332
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.