DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Dlx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001178675.1 Gene:Dlx2 / 296499 RGDID:1304853 Length:332 Species:Rattus norvegicus


Alignment Length:398 Identity:94/398 - (23%)
Similarity:149/398 - (37%) Gaps:118/398 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGA----PQLNETNSSIGVGGAGGG 152
            |:.|.::.::.......:|.|....|.:.|.||.||:..:..:    ||.:.|..          
  Rat     6 DSLVADMHSTQITASSTYHQHQQPPSGAGAGSGGSSNSSSSNSNLHKPQESPTLP---------- 60

  Fly   153 GGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLA---HHLSAVA 214
              |..|||    |:...:|||.|                  |.....:||:.|:.   :|.|.: 
  Rat    61 --VSTATD----SSYYTNQQHPA------------------GGGGGGASPYAHMGSYQYHASGL- 100

  Fly   215 NNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSS-----PN 274
                                  |:||.:.::|      :|.....||.:......|||     |:
  Rat   101 ----------------------NNVSYSAKSS------YDLGYTAAYTSYAPYGTSSSPVNNEPD 137

  Fly   275 LEDLS-DLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIW 338
            .|||. ::...:||.:...|.|.:|:.||...|::.:..::|:.:..::|||.:|.|::.|||||
  Rat   138 KEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIW 202

  Fly   339 FQNRRAKERKQNKKGSDPNVMGVGVQ----------HADYSQLLDAKAKLE---PGLHLSHSLAH 390
            |||||:|.:|..|.|..|.....|..          .|..|....|:.::.   ||...|.:.:.
  Rat   203 FQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAQQRMAGGGPGSGGSGAGSS 267

  Fly   391 SMNPMAAM-----NIP---------------AMRLHPHLAAHSHSLAAVAAHSHQLQQQHSAQMS 435
            ..:|.:|.     |.|               |..|||.....:|       |.|  ...|.|...
  Rat   268 GSSPSSAASAFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAH-------HHH--HHHHHAGGG 323

  Fly   436 AAAAVGTL 443
            |..:.||:
  Rat   324 APVSAGTI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
Dlx2NP_001178675.1 DLL_N 54..135 CDD:289198 27/143 (19%)
Homeobox 158..211 CDD:278475 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.