DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Dlx3

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001099302.1 Gene:Dlx3 / 287638 RGDID:1304875 Length:287 Species:Rattus norvegicus


Alignment Length:275 Identity:72/275 - (26%)
Similarity:119/275 - (43%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SGSEISSPGAPTSA-------SSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNN 243
            :||: .||..|.|:       |:|.|   .:.|........|      |.|:::..|.|.::...
  Rat    24 AGSK-DSPTLPESSVTDLGYYSAPQH---DYYSGQPYGQTVN------PYTYHHQFNLNGLAGTG 78

  Fly   244 RTSP--------SKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTD 300
            ..||        |...|..:.::| .|||....:...|..|    :...:||.:...|.|.:|:.
  Rat    79 AYSPKSEYTYGGSYRQYGAYREQP-LPAQDPVSVKEEPEAE----VRMVNGKPKKVRKPRTIYSS 138

  Fly   301 FQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQH 365
            :|...|::.:..::|:.:..::|||..|.|::.||||||||||:|.:|..|.|..|      ::|
  Rat   139 YQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVP------LEH 197

  Fly   366 A-DYSQLLDAKAKLEPGL--HLSHSL-AHSMNPMAAMNIPAMRLHPHLAA------------HSH 414
            : :.|..:...:...|.|  ..|||. |.:.||:.    |.:   |:.|:            |:.
  Rat   198 SPNNSDSMACNSPPSPALWDTSSHSTPAPTRNPLP----PPL---PYSASPNYLDDPTNSWYHTQ 255

  Fly   415 SLAAVAAHSHQLQQQ 429
            :|:     ...||||
  Rat   256 NLS-----GPHLQQQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 21/51 (41%)
Dlx3NP_001099302.1 DLL_N 27..107 CDD:403572 20/90 (22%)
COG5576 <109..230 CDD:227863 38/130 (29%)
Homeobox 132..186 CDD:395001 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.