DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and VAX2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_036608.1 Gene:VAX2 / 25806 HGNCID:12661 Length:290 Species:Homo sapiens


Alignment Length:310 Identity:79/310 - (25%)
Similarity:116/310 - (37%) Gaps:90/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IGVGGA------------GGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAP 196
            :|.|||            |||||..|...|.....        |:|....|..|:|         
Human     1 MGDGGAERDRGPARRAESGGGGGRCGDRSGAGDLR--------ADGGGHSPTEVAG--------- 48

  Fly   197 TSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSK---PPYFDWMKK 258
            ||||||           |.:..:..:::..|.....::....:..:.:.:..:   |...|    
Human    49 TSASSP-----------AGSRESGADSDGQPGPGEADHCRRILVRDAKGTIREIVLPKGLD---- 98

  Fly   259 PAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSE 323
                                   ||...:|||......:|    |||:|.:.|  :|:..|.::|
Human    99 -----------------------LDRPKRTRTSFTAEQLY----RLEMEFQRC--QYVVGRERTE 134

  Fly   324 LAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSL 388
            ||:.|:|||.|||:||||||.|::|...:..:........:....|.:|   ..||.|..||...
Human   135 LARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSASEAFATSNIL---RLLEQGRLLSVPR 196

  Fly   389 AHSMNPMAAMNIPAMRLHPHLAAHSH---SLAAVAAHSHQLQQQHSAQMS 435
            |.|:..:.    |::   |.|.| ||   ||......|.:|....||..|
Human   197 APSLLALT----PSL---PGLPA-SHRGTSLGDPRNSSPRLNPLSSASAS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
VAX2NP_036608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 24/101 (24%)
Homeobox 105..158 CDD:306543 28/58 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..240 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.