DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Msx2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_037114.2 Gene:Msx2 / 25483 RGDID:3116 Length:267 Species:Rattus norvegicus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:106/274 - (38%) Gaps:82/274 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 AGGGGGVGGATDGGP------GSAPPNHQQHIAEGLPS---PPITVSGSEISSPGAPTSASS--- 201
            ||.|.|.|||..|..      .|.|     ...|.|.|   ||       ..||..|...:|   
  Rat    22 AGPGPGPGGAEGGAEERRVKVSSLP-----FSVEALMSDKKPP-------KESPAVPPDCASAGA 74

  Fly   202 -------PHHHL--AHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMK 257
                   |.|.:  ||                 ||..........||.:.|  |....|   |::
  Rat    75 VLRPLLLPGHGVRDAH-----------------SPGPLVKPFETASVKSEN--SEDGAP---WIQ 117

  Fly   258 KPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKS 322
            :|...:.|...:  ||....|.       |.:|..|.|..:|..|.|.||:::...:|::|..::
  Rat   118 EPGRYSPPPRHM--SPTTCTLR-------KHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERA 173

  Fly   323 ELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHS 387
            |.:.:|:|:|.||||||||||||.::              :|.|:..:|   |...:|.|....|
  Rat   174 EFSSSLNLTETQVKIWFQNRRAKAKR--------------LQEAELEKL---KMAAKPMLPSGFS 221

  Fly   388 LAHSMN-PMAAMNI 400
            |...:| |:.|.:|
  Rat   222 LPFPINSPLQAASI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 24/51 (47%)
Msx2NP_037114.2 Homeobox 145..199 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.