DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Vax2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_036042.1 Gene:Vax2 / 24113 MGIID:1346018 Length:292 Species:Mus musculus


Alignment Length:290 Identity:71/290 - (24%)
Similarity:114/290 - (39%) Gaps:80/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GVGGA-TDGG------PGSAPPNHQQHI-AEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHL 210
            |.||| .|.|      ||.....|.:|. ||.|.:...:.|..||    |.||||||        
Mouse     2 GDGGAERDRGPKRREEPGGRSGRHGEHRGAEDLRADTGSASPREI----AGTSASSP-------- 54

  Fly   211 SAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSK---PPYFDWMKKPAYPAQPQPDLSSS 272
               |.:..:..:::...:....::....:..:.:.:..:   |...|                  
Mouse    55 ---AGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLD------------------ 98

  Fly   273 PNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKI 337
                     ||...:|||......:|    |||:|.:.|  :|:..|.::|||:.|:|||.|||:
Mouse    99 ---------LDRPKRTRTSFTAEQLY----RLEMEFQRC--QYVVGRERTELARQLNLSETQVKV 148

  Fly   338 WFQNRRAKERKQNKKGSDPNVMGVGVQ---HADYSQLLDAKAKLE--------------PGLHLS 385
            ||||||.|::|...:..:........:   .::..:||:....|.              |||..|
Mouse   149 WFQNRRTKQKKDQSRDLEKRASSSASEAFATSNVLRLLEQGRLLSVPRAPSLLALTPGLPGLPAS 213

  Fly   386 HSLAHSMNPMAAMNIPAMRLHPHLAAHSHS 415
            |.....::|..:    :.||:|..:|.:.|
Mouse   214 HRGTSLVDPRNS----SPRLNPMPSASASS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
Vax2NP_036042.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74 24/86 (28%)
Homeobox 105..158 CDD:278475 28/58 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..242 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.