DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Urad

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001034767.1 Gene:Urad / 231903 MGIID:3647519 Length:178 Species:Mus musculus


Alignment Length:174 Identity:33/174 - (18%)
Similarity:68/174 - (39%) Gaps:47/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 WMKKPAYPAQPQPDLSSSPNLEDLSD----LLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRY 315
            |.::|            ...||||.:    .:||..::..:...| .:.|....:|::...|:. 
Mouse    33 WSQRP------------FSGLEDLENHFFAFIDALPRSGQEGILR-CHPDLAGRDLQQGTLTAE- 83

  Fly   316 ITIRRKSELAQTLSLSERQVKIWFQNRRAKER---------KQNKKGSDPNVMGVGVQHADYSQL 371
             :.|.:|:...|...::.::::...|.:.:||         :.:.:.:.|..:...:|....|:|
Mouse    84 -SQREQSQAGLTSLDTDDRLRLQQLNAQYRERFGFPFVLAARLSDRATVPRELARRLQCQPESEL 147

  Fly   372 LDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPHLAAHSHS 415
            ..|..:::   .:||                :||...|.|||||
Mouse   148 RTALGEVK---KISH----------------LRLTDLLGAHSHS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 8/51 (16%)
UradNP_001034767.1 OHCU_decarbox 10..162 CDD:286439 25/162 (15%)
Substrate binding. /evidence=ECO:0000250 84..88 1/3 (33%)
Substrate binding. /evidence=ECO:0000250 119..123 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.