DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Rax

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_038861.2 Gene:Rax / 19434 MGIID:109632 Length:342 Species:Mus musculus


Alignment Length:210 Identity:56/210 - (26%)
Similarity:94/210 - (44%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PGSAPPNHQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSP 227
            ||.||.     :|:|    ..:::|..:.|||..||.       .|.:.|:......:...:..|
Mouse     4 PGCAPA-----MADG----SFSLAGHLLRSPGGSTSR-------LHSIEAILGFTKEDGILDTFP 52

  Fly   228 STHNNNNNN-------------NSVSNNNRTSPSKPPYF--DW-MKKPAYP-----AQPQPDLSS 271
            :..::.::.             .:.:..:.:||...|.|  :: ..:|.||     |:|.|.||.
Mouse    53 AERSSRSSKERDPRLGAQPACPKAPAGGSESSPPAAPGFVPEYEATRPCYPKEQGEARPSPGLSV 117

  Fly   272 SPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVK 336
            .|...| |.|.:.....:...:.|..:|.:|..|||:.:..|.|..:..:.|||..::|.|.:|:
Mouse   118 GPAAGD-SKLSEEEPPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQ 181

  Fly   337 IWFQNRRAKERKQNK 351
            :||||||||.|:|.|
Mouse   182 VWFQNRRAKWRRQEK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 22/54 (41%)
RaxNP_038861.2 Octapeptide motif 33..40 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..140 17/96 (18%)
Homeodomain 137..193 CDD:459649 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..295
OAR 316..331 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332
Nuclear localization signal. /evidence=ECO:0000255 325..329
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.