DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and alr-1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_509860.1 Gene:alr-1 / 181302 WormBaseID:WBGene00044330 Length:362 Species:Caenorhabditis elegans


Alignment Length:223 Identity:57/223 - (25%)
Similarity:94/223 - (42%) Gaps:54/223 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 AHHLSAVANNNN--NNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDL 269
            |..::|:.||.:  ..::...:|:..|.....:.:.|....|||                   |.
 Worm    60 AFSIAALTNNQHELKEDDGKKTPTGDNILEAASVLDNRENGSPS-------------------DG 105

  Fly   270 SSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQ 334
            ::||         |.:|| |.:.:||..::.||..||||.:..:.|..:..:.|||..:.|:|.:
 Worm   106 TNSP---------DDNGK-RKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEAR 160

  Fly   335 VKIWFQNRRAKERKQ----------------NKKGSDPNVMGVGVQHADYSQLLDAKAK--LEPG 381
            |::||||||||.|||                |..|.:|..|.:. |.|.::.:....|.  |...
 Worm   161 VQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSNGDNPYQMMLS-QEAIFAAINQQAAAHLLNEQ 224

  Fly   382 LHLSHSLAHSMNPMAAMNIPAMRLHPHL 409
            :.::.|...|.:|    ::|.....|.|
 Worm   225 VRIATSDRRSQSP----SVPVTTSSPIL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
alr-1NP_509860.1 Homeobox 121..174 CDD:365835 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.