DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and pal-1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001021209.1 Gene:pal-1 / 175638 WormBaseID:WBGene00003912 Length:270 Species:Caenorhabditis elegans


Alignment Length:251 Identity:75/251 - (29%)
Similarity:112/251 - (44%) Gaps:69/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GSSSSGGAP-----GAPQLNETNSSIGVGGAGGGGGVGGATDGGP----GSAPPNHQQHIAEGLP 179
            |.:...|.|     |.|||          .|.|......|.|..|    ||:..:...:     |
 Worm    64 GDTGFYGHPDLYPFGLPQL----------AANGQIPAVEAVDVKPPLSNGSSSSDSGMY-----P 113

  Fly   180 SP-------PITVSGSEISSPGAPTSASSPHHHL------AHHLSAVANNNNNNNNNNNSPSTHN 231
            ||       |.|.||:..||..:..:|::.::.:      ...:....:.......:...|..:|
 Worm   114 SPSDMMTPFPSTSSGAASSSELSAAAAAAANYQMRAATCYQQSVWPFMDYQQFQGFSWKMPLGNN 178

  Fly   232 NNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRV 296
            :..:..| |::.:|.|:.|                    .:.|:           :.||.||||:
 Worm   179 HGKDRRS-SSDGKTLPTGP--------------------GTNNV-----------RVRTADKYRM 211

  Fly   297 VYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            ||:|:||||||||:.||.:||..|||:|:..|||:|||:||||||||||:|:..:|
 Worm   212 VYSDYQRLELEKEFHTSPFITSDRKSQLSTMLSLTERQIKIWFQNRRAKDRRDKQK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 36/51 (71%)
pal-1NP_001021209.1 Homeobox 210..262 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5303
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - oto19350
orthoMCL 1 0.900 - - OOG6_107786
Panther 1 1.100 - - LDO PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.