DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and DLX6

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_005213.3 Gene:DLX6 / 1750 HGNCID:2919 Length:293 Species:Homo sapiens


Alignment Length:286 Identity:71/286 - (24%)
Similarity:121/286 - (42%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PGSAPPNHQQHIAEGLPSPPITVSGSE-----ISSPGAPTSASSPHHHLAHHLSAVANNNNNNNN 222
            |...||..|.|..:..|:    ::|:.     :.|..|..:|.|.|||  ||          .::
Human    46 PPPPPPPPQPHSQQSSPA----MAGAHYPLHCLHSAAAAAAAGSHHHH--HH----------QHH 94

  Fly   223 NNNSPSTHNNNNNNNSVSNNNRTSPSKP--------PYFDWMKKPAYPAQPQPDLSSSPNLEDLS 279
            ::.||......|     |.|:|:..:.|        ||.......:..||.:.|.:.......:.
Human    95 HHGSPYASGGGN-----SYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIE 154

  Fly   280 D-LLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRR 343
            : .:..:||.:...|.|.:|:..|...|...:..::|:.:..::|||.:|.|::.||||||||:|
Human   155 NGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKR 219

  Fly   344 AKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLEPGLHLSHSLAHSMNPMAAMNIPAMRLHPH 408
            :|.:|..|:||:|:          .|..|...|.|.|   .|.:|....:..|:....:|..:.:
Human   220 SKFKKLLKQGSNPH----------ESDPLQGSAALSP---RSPALPPVWDVSASAKGVSMPPNSY 271

  Fly   409 LAAHSHSLAAVAAHSHQLQQQHSAQM 434
            :..:||..::    .||...|....|
Human   272 MPGYSHWYSS----PHQDTMQRPQMM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
DLX6NP_005213.3 COG5576 119..>231 CDD:227863 31/111 (28%)
Homeobox 170..223 CDD:278475 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.