DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and DLX4

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:258 Identity:60/258 - (23%)
Similarity:108/258 - (41%) Gaps:55/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PITVSGSEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTS 246
            |:.:|.:..:||.  .|.|.|:.||..:                 |.|...|..::.:|.....:
Human    32 PLGLSPTTAASPN--LSYSRPYGHLLSY-----------------PYTEPANPGDSYLSCQQPAA 77

  Fly   247 PSKPPYFDWMKKPA-YPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEY 310
            .|:|     :..|| :|.:.:.| |..|.|.............:...|.|.:|:..|...|.:.:
Human    78 LSQP-----LCGPAEHPQELEAD-SEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRF 136

  Fly   311 CTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAK 375
            ..::|:.:..:::||..|.|::.||||||||:|:|.:|..|:.|       |.|..|:       
Human   137 QHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNS-------GGQEGDF------- 187

  Fly   376 AKLEPGLHLSHSLAHSMNPMAAM-NIPAMRLHPHLAAHSHSLAAVAAHSHQLQQQHSAQMSAA 437
                ||  .:.|::....|:.:: ::|.....| .:.:.:|..|       ..|.||:.:.|:
Human   188 ----PG--RTFSVSPCSPPLPSLWDLPKAGTLP-TSGYGNSFGA-------WYQHHSSDVLAS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 19/51 (37%)
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 8/45 (18%)
Homeobox 120..173 CDD:306543 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.