DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and DLX2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_004396.1 Gene:DLX2 / 1746 HGNCID:2915 Length:328 Species:Homo sapiens


Alignment Length:405 Identity:93/405 - (22%)
Similarity:137/405 - (33%) Gaps:136/405 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGSSSSGG--------APGAPQLNETNSSIGVG- 147
            |:.|.::.::.......:|.|....|...|..|.:||..        :|..|....|:||.... 
Human     6 DSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQ 70

  Fly   148 --GAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSGS-EISSPGAPTS------ASSPH 203
              .||||||      ||...|.....|:.|.||.:.|.:...| ::....|.||      :||| 
Human    71 QHPAGGGGG------GGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSP- 128

  Fly   204 HHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPD 268
                      |||                                                    
Human   129 ----------ANN---------------------------------------------------- 131

  Fly   269 LSSSPNLEDLS-DLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSE 332
               .|..|||. ::...:||.:...|.|.:|:.||...|::.:..::|:.:..::|||.:|.|::
Human   132 ---EPEKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQ 193

  Fly   333 RQVKIWFQNRRAKERKQNKKGSDPNVM--GVGVQHADYSQLLDAKAKLE------------PGLH 383
            .||||||||||:|.:|..|.|..|:..  |........|..:.|.|..:            ||..
Human   194 TQVKIWFQNRRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSG 258

  Fly   384 LSHSLAHSMNPMAAM-----NIP---------------AMRLHPHLAAHSHSLAAVAAHSHQLQQ 428
            .|.:.:...:|.:|.     |.|               |..|||......|       |.|    
Human   259 GSGAGSSGSSPSSAASAFLGNYPWYHQTSGSASHLQATAPLLHPTQTPQPH-------HHH---- 312

  Fly   429 QHSAQMSAAAAVGTL 443
            .|.....|..:.||:
Human   313 HHHGGGGAPVSAGTI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 22/51 (43%)
DLX2NP_004396.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..81 18/70 (26%)
DLL_N 51..132 CDD:289198 29/152 (19%)
Homeobox 155..208 CDD:278475 22/52 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..270 10/58 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..328 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.