DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and NKX6-3

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001351770.1 Gene:NKX6-3 / 157848 HGNCID:26328 Length:265 Species:Homo sapiens


Alignment Length:256 Identity:61/256 - (23%)
Similarity:94/256 - (36%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 APPNHQQHIAEGLPSPPITVSGSEISSPGAPTSASSPHHHLAHHLSAVAN-NNNNNNNNNNSPST 229
            :||.....:|.|.|.....:....:::|.....:..||         ||. ...::.....||..
Human    39 SPPGLGPQLAAGTPHGITDILSRPVAAPNNSLLSGYPH---------VAGFGGLSSQGVYYSPQV 94

  Fly   230 HNNNNNNNSVSNNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKY 294
            .|.:...|......|...:.... ||.........|.|          |||.:.....||.    
Human    95 GNFSKAGNEYPTRTRNCWADTGQ-DWRGGRQCSNTPDP----------LSDSIHKKKHTRP---- 144

  Fly   295 RVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQN---KKGSDP 356
              .:|..|...|||.:..::|:....::.||.:|.::|.|||:||||||.|.||::   ...|.|
Human   145 --TFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTP 207

  Fly   357 NV-----MGVGVQHA-------DYSQLL-----DAKAKLEPGLHLSHSLAHSMNPMAAMNI 400
            ..     .|.|...|       :|::.|     |.|.:|   |...|..|.|:..:.|.::
Human   208 RAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRL---LLRKHRAAFSVLSLGAHSV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
NKX6-3NP_001351770.1 Homeobox 142..195 CDD:306543 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.