DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Hoxc5

DIOPT Version :10

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:192 Identity:55/192 - (28%)
Similarity:86/192 - (44%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PSPPITVSGSEISS-----PGAP--TSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNN 236
            |:|..::.|.::::     |..|  ::|::|.|.|... .|...|....:.....|:......::
Mouse    52 PAPSNSLHGVDMAANPRAHPDRPACSAAAAPGHALGRD-EAAPLNPGMYSQKAARPALEERAKSS 115

  Fly   237 NSVSNNNRTS---------PSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKD 292
            ..:......:         |:.|..:.||.|                       |..|.:|..| 
Mouse   116 GEIKEEQAQTGQPAGLSQPPAPPQIYPWMTK-----------------------LHMSHETDGK- 156

  Fly   293 KYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGS 354
            :.|..||.:|.||||||:..:||:|.||:.|:|..|.|:|||:||||||||.|.:|.:|..|
Mouse   157 RSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeodomain 293..348 CDD:459649 31/54 (57%)
Hoxc5NP_783857.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 11/73 (15%)
Antp-type hexapeptide 140..145 1/4 (25%)
Homeodomain 156..212 CDD:459649 32/56 (57%)

Return to query results.
Submit another query.