DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Nkx6-2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_899071.2 Gene:Nkx6-2 / 14912 MGIID:1352738 Length:277 Species:Mus musculus


Alignment Length:332 Identity:75/332 - (22%)
Similarity:106/332 - (31%) Gaps:122/332 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AAAHQMYYNSHHMFHSAAAASAGEWHSPA-SSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSAS 122
            ||.|.|......:|..|....|| :.:|| .|.........|             |..:......
Mouse    17 AALHNMAEMKTSLFPYALQGPAG-FKTPALGSLGAQLPLGTP-------------HGISDILGRP 67

  Fly   123 SGSSSSGGAPGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNHQQHIAEGLPSPPITVSG 187
            .|::..|.....|:||...||.||             ..||.:|       :|.|.|.|      
Mouse    68 VGAAGGGLLGSLPRLNGLASSAGV-------------YFGPAAA-------VARGYPKP------ 106

  Fly   188 SEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPSKPPY 252
                              ||.                                     .|.:||.
Mouse   107 ------------------LAE-------------------------------------LPGRPPI 116

  Fly   253 FDWMKKPAYPAQPQPDLSSSPNL---EDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSR 314
            |       :|...|......|.|   .....:||..||   |...|..::..|...|||.:..::
Mouse   117 F-------WPGVVQGSPWRDPRLAGSAQAGGVLDKDGK---KKHSRPTFSGQQIFALEKTFEQTK 171

  Fly   315 YITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQN---------KKGSDPNVMGVGVQHA---- 366
            |:....::.||.:|.::|.|||:||||||.|.||::         |:.||...:.||...|    
Mouse   172 YLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDD 236

  Fly   367 DYSQLLD 373
            :|::.||
Mouse   237 EYNRPLD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 20/51 (39%)
Nkx6-2NP_899071.2 Homeobox 151..205 CDD:395001 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.