DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and Dlx3

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_034185.1 Gene:Dlx3 / 13393 MGIID:94903 Length:287 Species:Mus musculus


Alignment Length:275 Identity:72/275 - (26%)
Similarity:118/275 - (42%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SGSEISSPGAPTSA-------SSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNN 243
            :||: .||..|.|.       |:|.|   .:.|........|      |.|:::..|.|.::...
Mouse    24 AGSK-DSPTLPESTVTDLGYYSAPQH---DYYSGQPYGQTVN------PYTYHHQFNLNGLAGTG 78

  Fly   244 RTSP--------SKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTD 300
            ..||        |...|..:.::| .|||....:...|..|    :...:||.:...|.|.:|:.
Mouse    79 AYSPKSEYTYGGSYRQYGAYREQP-LPAQDPVSVKEEPEAE----VRMVNGKPKKVRKPRTIYSS 138

  Fly   301 FQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVGVQH 365
            :|...|::.:..::|:.:..::|||..|.|::.||||||||||:|.:|..|.|..|      ::|
Mouse   139 YQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVP------LEH 197

  Fly   366 A-DYSQLLDAKAKLEPGL--HLSHSL-AHSMNPMAAMNIPAMRLHPHLAA------------HSH 414
            : :.|..:...:...|.|  ..|||. |.:.||:.    |.:   |:.|:            |:.
Mouse   198 SPNNSDSMACNSPPSPALWDTSSHSTPAPARNPLP----PPL---PYSASPNYLDDPTNSWYHTQ 255

  Fly   415 SLAAVAAHSHQLQQQ 429
            :|:     ...||||
Mouse   256 NLS-----GPHLQQQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 21/51 (41%)
Dlx3NP_034185.1 DLL_N 27..107 CDD:315147 20/90 (22%)
Abdominal-A <109..224 CDD:332641 37/124 (30%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:O60479 131..181 19/49 (39%)
Homeobox 132..185 CDD:306543 21/52 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.