DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and VAX1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001106175.1 Gene:VAX1 / 11023 HGNCID:12660 Length:334 Species:Homo sapiens


Alignment Length:210 Identity:64/210 - (30%)
Similarity:89/210 - (42%) Gaps:44/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 AYPAQPQPDLSSSPNLEDLSD----------------LLDASGKTR-----------TKDKYRVV 297
            |:..:||...|:|...||.:.                :.||.|..|           ...:.|..
Human    42 AFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTS 106

  Fly   298 YTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVG 362
            :|..|...||.|:...:|:..|.::|||:.|:|||.|||:||||||.|::|.  :|.|..:..|.
Human   107 FTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKD--QGKDSELRSVV 169

  Fly   363 VQHADYSQLLDAKAKLEPGLHLS-HSLAHSMNPMAAMNIPAMRLHPHLAAHSHSLAAVAAHSHQL 426
            .:.|....:|   ..||.|..|| ..|...:.|.|...:.:....|.|.|    |.|.||..   
Human   170 SETAATCSVL---RLLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPA----LGAGAAAG--- 224

  Fly   427 QQQHSAQMSAAAAVG 441
                ||..:||||.|
Human   225 ----SAAAAAAAAPG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
VAX1NP_001106175.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
COG5576 66..184 CDD:227863 36/122 (30%)
Homeobox 103..157 CDD:365835 25/53 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..263 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.