DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and CDX2

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:XP_011533177.1 Gene:CDX2 / 1045 HGNCID:1806 Length:321 Species:Homo sapiens


Alignment Length:303 Identity:111/303 - (36%)
Similarity:136/303 - (44%) Gaps:81/303 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MFHSAAAASAGEWHSPASSTADNFVQNVPTSAHQLMQQHHHHHAHASSSSASSGSSSSGG----- 130
            |:.|:...|.|...:|     .|||     |..|......:|.|.|::::|:..|:.|.|     
Human    13 MYPSSVRHSGGLNLAP-----QNFV-----SPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPA 67

  Fly   131 APGAPQLNETNSSIGVGGAGGGGGVG-GATDGGPGSA----------PPNHQQHIAEGLPSPPIT 184
            |.|||...:.|.....|.|.....|. |...|.|.:|          |.:|..|......:.|..
Human    68 AYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSC 132

  Fly   185 VSG-SEISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTSPS 248
            .|| .:..:||.|..|::.   .|..||......|                              
Human   133 ASGLLQTLNPGPPGPAATA---AAEQLSPGGQRRN------------------------------ 164

  Fly   249 KPPYFDWMKKPAYPAQPQPDLSS----SPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKE 309
               ..:||:|||     |..|.|    ||:         ::.||||||||||||||.||||||||
Human   165 ---LCEWMRKPA-----QQSLGSQALTSPS---------STVKTRTKDKYRVVYTDHQRLELEKE 212

  Fly   310 YCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            :..|||||||||:|||.||.|||||||||||||||||||.|||
Human   213 FHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 44/51 (86%)
CDX2XP_011533177.1 Caudal_act 13..171 CDD:282574 45/203 (22%)
Homeobox 198..250 CDD:278475 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7170
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4560
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm40805
orthoMCL 1 0.900 - - OOG6_107786
Panther 1 1.100 - - O PTHR24332
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.940

Return to query results.
Submit another query.