DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and CDX1

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001795.2 Gene:CDX1 / 1044 HGNCID:1805 Length:265 Species:Homo sapiens


Alignment Length:254 Identity:94/254 - (37%)
Similarity:111/254 - (43%) Gaps:88/254 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PGAPQLNETNSSIGVGGAGGGGGVGGATDGGPGSAPPNH-----QQHIAEGLPSPPITVSGSEIS 191
            |..|      :|:|:|....|       ...|..|||.:     ..|: |..|:|| |..|:...
Human    17 PARP------ASLGLGPQAYG-------PPAPPPAPPQYPDFSSYSHV-EPAPAPP-TAWGAPFP 66

  Fly   192 S----------PGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSVSNNNRTS 246
            :          ||....|:||        :::|.                               
Human    67 APKDDWAAAYGPGPAAPAASP--------ASLAF------------------------------- 92

  Fly   247 PSKPPYFDWMKKPAYP-----AQP--QPDLSSSPNLEDLSDLL-----------DASGKTRTKDK 293
             ..||.|..:..|..|     |||  .|...|||..:..:...           ..|||||||||
Human    93 -GPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGKTRTKDK 156

  Fly   294 YRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKK 352
            |||||||.||||||||:..|||||||||||||..|.|:|||||||||||||||||.|||
Human   157 YRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 43/51 (84%)
CDX1NP_001795.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 9..153 39/190 (21%)
Caudal_act 13..138 CDD:282574 35/175 (20%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:28473536 157..178 16/20 (80%)
Homeobox 158..210 CDD:278475 43/51 (84%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000305|PubMed:28473536 196..207 10/10 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..265 8/9 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7170
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4560
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001802
OrthoInspector 1 1.000 - - otm40805
orthoMCL 1 0.900 - - OOG6_107786
Panther 1 1.100 - - LDO PTHR24332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2707
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.