DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cad and not

DIOPT Version :9

Sequence 1:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001164669.1 Gene:not / 100038059 XenbaseID:XB-GENE-478518 Length:236 Species:Xenopus tropicalis


Alignment Length:239 Identity:68/239 - (28%)
Similarity:98/239 - (41%) Gaps:63/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ISSPGAPTSASSPHHHLAHHLSAVANNNNNNNNNNNSPSTHNNNNNNNSV-SNNNR--------- 244
            :.||..|...    ||||.|.:.        :.::..|.|...:.|.:|: |..:|         
 Frog     2 LHSPVFPAFG----HHLAEHPAM--------SISSELPRTPKASFNIDSILSRADRPVPKVSMEM 54

  Fly   245 ------TSPSKP--------PYFD-WMKKP--AYPAQ-------------PQPD---------LS 270
                  :.||.|        ||.. |:.||  .||:.             |.||         .|
 Frog    55 PSWQPPSPPSVPYRYSYGMMPYPPVWLIKPTVGYPSMAQQQPMRMPRGECPCPDPACKERGLLYS 119

  Fly   271 SSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLELEKEYCTSRYITIRRKSELAQTLSLSERQV 335
            ..|| ..::.|...:|..:.| :.|.|:|..|...||||:...:|:....:.:||.||:|:|.||
 Frog   120 HCPN-GSMNPLSWRTGPCKMK-RIRTVFTPEQLERLEKEFLKQQYMVGTERVDLASTLNLTETQV 182

  Fly   336 KIWFQNRRAKERKQNKKGSDPNVMGVGVQHADYSQLLDAKAKLE 379
            |:||||||.|.|||:.:.....:...||..||.|...|...:.|
 Frog   183 KVWFQNRRIKWRKQSLEQKKAKLSQFGVIPADSSDHTDDSRETE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cadNP_001260641.1 Homeobox 295..347 CDD:278475 25/51 (49%)
notNP_001164669.1 Homeobox 142..194 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.