DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and AT3G32410

DIOPT Version :10

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:NP_683622.2 Gene:AT3G32410 / 823028 AraportID:AT3G32410 Length:232 Species:Arabidopsis thaliana


Alignment Length:87 Identity:18/87 - (20%)
Similarity:29/87 - (33%) Gaps:31/87 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 HKGYCDPNFENRNFNIDTSLLLDDIVEKAKAKESKRSEEYEKKIEQLESAKQEAEAKAAHLEEKV 497
            ||.|.|||          |:|                    ||:::....:...: :..|.:...
plant   102 HKSYADPN----------SIL--------------------KKVDESRGLRFSVQ-RNVHSKIFS 135

  Fly   498 KLMEANGVAAPSPNKLPKVNIP 519
            ..|..:.|.:|.||:.|....|
plant   136 PRMVQSPVTSPLPNRSPTQGSP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:461886
Drf_FH3 253..453 CDD:461885 7/19 (37%)
FH2 608..983 CDD:396655
AT3G32410NP_683622.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.