DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and inf2

DIOPT Version :9

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:XP_021322927.1 Gene:inf2 / 792715 ZFINID:ZDB-GENE-140711-5 Length:238 Species:Danio rerio


Alignment Length:186 Identity:41/186 - (22%)
Similarity:83/186 - (44%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LRVALTSNPISWIKEF-GVAGIG----TIEKLLARSKNNASYEKIEFEAIRCLKAIMNNTWGLNV 211
            ||..|..:..:|:.:| .::|:.    .:::|..|..:..:...::...:.|::|:||::.|::.
Zfish    57 LRKRLEGSEEAWMVQFLELSGLDLLLEALDRLSGRGCSRIADALLQLTCVSCVRAVMNSSAGIHF 121

  Fly   212 VLNPDQHSVVLLLAQSLDPRKPQTMCEALKLLASFCIVYERNGYEKVLRAITTIAATSFKASERF 276
            ::  |....|..|:|:||........:..:|||:.. ::...|:...|.|:........: ..||
Zfish   122 IV--DNEGYVRKLSQALDTSNTMVKKQVFELLAALS-MFSSEGHRLALDALEHYKCVKTQ-QYRF 182

  Fly   277 RPIVDALFASDQQDPKRDLACHSLIFINTLTNTPTDLNFRLHLRCEIMRMGLYDRL 332
            ..|::.|.::|.......|    |..||.|..:...|..|..:|.|.:.:.|...|
Zfish   183 SVIMNELRSTDNVPYMVTL----LSVINALIFSADGLQQRDKMRKEFIGLQLLQLL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:283920 22/100 (22%)
Drf_FH3 253..453 CDD:283917 19/80 (24%)
FH2 608..983 CDD:280362
inf2XP_021322927.1 Drf_GBD <98..154 CDD:310750 14/57 (25%)
Drf_FH3 160..>226 CDD:310747 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.