DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and fhdc3

DIOPT Version :9

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:NP_001071184.1 Gene:fhdc3 / 777608 ZFINID:ZDB-GENE-061103-76 Length:755 Species:Danio rerio


Alignment Length:522 Identity:128/522 - (24%)
Similarity:223/522 - (42%) Gaps:101/522 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 KNPMKRANWKAIVP--AKMSDKAFWVKCQEDKLAQDDFLAELAVK-----FSSKPVKKEQKDAVD 672
            ::.|:..||.|| |  :.:..:..|...:.    .::|  ||..|     ||    ..|....:.
Zfish    12 RSRMRNFNWDAI-PRHSVLGKRNVWTAHRN----LENF--ELDTKRMEELFS----HNEHHGLIR 65

  Fly   673 KPTTLTK----------KNVDLRVLDSKTAQNLAIMLGGSLKHLSYEQIKICLLRCDTDIL---- 723
            |..|:.|          ::.::.:|:||.:.|:.|:|         :|.|    |...||:    
Zfish    66 KGGTVRKSVWGLSQIAAESENVSILNSKKSMNIGILL---------KQFK----RTPKDIVEAVR 117

  Fly   724 ------SSNILQQLIQYLPPPEHLKRLQEIKAKGEPLPPIEQFAATIGEIKRLSPRLHNLNFKLT 782
                  :|..|::|.:.||.....|:|.........|...::|...:.::.....||.:|..:..
Zfish   118 NGNMCFASGKLRELNKLLPDDVETKKLMSFNGDLSALNDADRFMVMMVQVPGYKVRLKSLLLREE 182

  Fly   783 YADMVQDIKPDIVAGTAACEEIRNSKKFSKILELILLLGNYMNSGSKNEAAFGFEISYLTKLSNT 847
            :...:::||..|...|.|..|:........|:.|:|..|||||:|....:|.||.::.|.||.:|
Zfish   183 FFPFIEEIKHSIAVMTTAANELLACDDLHSIIRLVLKAGNYMNAGGYAGSAIGFRMASLLKLVDT 247

  Fly   848 KDADNKQTLLHYLADLVEKKFPDALNFYDDLSHVNKASRVNMDAIQKAMRQMNSAVKNLETDLQN 912
            |.......|:||:....::.....|:|.|.|.|:..|:|     |||...:|     :.:.:|:.
Zfish   248 KANKPGMNLMHYVTMQAQQIDEALLHFTDQLQHIGIAAR-----IQKQEVEM-----DFQRELEK 302

  Fly   913 NKVPQCDDDKFSEVMGKFAEECR----QQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEFFA 973
            .|..:.|..|..:::.:.....|    :.:||...:| ::|.:...::||:..|.:.:.:||..:
Zfish   303 IKEAKIDASKQPDLLHQMEAFLRMADIRLMDVEASLQ-ELEAISTSVAEYFCEDAATFKLEECCS 366

  Fly   974 DIKTFKDAFQAAHNDNVRVREELEKKRRLQEAREQSAREQQERQQRKKAVVDMDAPQ-------T 1031
            ...:|.:.|:.|                .||.|::.|.|.::||||::.::...|.:       |
Zfish   367 IFHSFCERFEKA----------------AQENRDREAAETRKRQQREREILTKTAKRRSTGSCST 415

  Fly  1032 QEGVMD-SLLEALQTGSAFGQRNRQARRQRPAGAERRAQLSRSRSRTRVTNGQLMTREMILNEVL 1095
            |:|..| |.||::.| |...||   ..|:||.|     ..|.:.|..:....|:..||.  ||.|
Zfish   416 QDGNNDNSTLESVLT-SFLKQR---PSRRRPGG-----PTSVANSLVKNIRPQVEKRED--NENL 469

  Fly  1096 GS 1097
            .|
Zfish   470 DS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:283920
Drf_FH3 253..453 CDD:283917
FH2 608..983 CDD:280362 92/398 (23%)
fhdc3NP_001071184.1 FH2 14..376 CDD:302999 92/396 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.