DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and AT3G32420

DIOPT Version :10

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:NP_001326212.1 Gene:AT3G32420 / 28719358 AraportID:AT3G32420 Length:107 Species:Arabidopsis thaliana


Alignment Length:138 Identity:29/138 - (21%)
Similarity:53/138 - (38%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 ASERFRPIVDALFASDQQDPKRDLACHSLIFINTLTNTPTDLNFRLHLRCEIMRMGLYDRLDEFT 336
            ||:|...::.::       |||..|      :........:| .::.:.|.|    |.|.:.|. 
plant     2 ASDRTSKVLFSM-------PKRSKA------VRQYKKADCEL-VKIDINCHI----LGDVVLEC- 47

  Fly   337 KIVEASNNENLQQHFKIFNEIREDDFEEFVQRFDNVTFNMDDATDCFDVLKNLVTDTTSEPYFLS 401
             |...|:.|..:..|::.       |.....|.:.:|.|..:    .|||.| .||...:.:...
plant    48 -ITLGSDLEREEMMFRVV-------FNTAFLRSNILTLNRGE----IDVLLN-TTDRFPKDFSAE 99

  Fly   402 ILQHLLYI 409
            :..:||::
plant   100 VTTYLLFL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:461886
Drf_FH3 253..453 CDD:461885 29/138 (21%)
FH2 608..983 CDD:396655
AT3G32420NP_001326212.1 PTEN_C2 <8..100 CDD:463081 24/123 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.