powered by:
Protein Alignment dia and AT3G25493
DIOPT Version :9
Sequence 1: | NP_001246113.1 |
Gene: | dia / 35340 |
FlyBaseID: | FBgn0011202 |
Length: | 1098 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001326334.1 |
Gene: | AT3G25493 / 28719318 |
AraportID: | AT3G25493 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 14/71 - (19%) |
Similarity: | 33/71 - (46%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 910 LQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEF--F 972
:|:....:.:..:|||.|..|.:...:::..:...:.....|.|:::||:..:.:|.....| |
plant 32 VQSTITEESNSQRFSESMETFLKRAEEEIIRVQAQESVALSLVKEITEYFHGNSAKEEAHPFRIF 96
Fly 973 ADIKTF 978
..::.|
plant 97 LVVRDF 102
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dia | NP_001246113.1 |
Drf_GBD |
66..248 |
CDD:283920 |
|
Drf_FH3 |
253..453 |
CDD:283917 |
|
FH2 |
608..983 |
CDD:280362 |
14/71 (20%) |
AT3G25493 | NP_001326334.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1204639at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.