DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and AT3G25493

DIOPT Version :9

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:NP_001326334.1 Gene:AT3G25493 / 28719318 AraportID:AT3G25493 Length:160 Species:Arabidopsis thaliana


Alignment Length:71 Identity:14/71 - (19%)
Similarity:33/71 - (46%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   910 LQNNKVPQCDDDKFSEVMGKFAEECRQQVDVLGKMQLQMEKLYKDLSEYYAFDPSKYTMEEF--F 972
            :|:....:.:..:|||.|..|.:...:::..:...:.....|.|:::||:..:.:|.....|  |
plant    32 VQSTITEESNSQRFSESMETFLKRAEEEIIRVQAQESVALSLVKEITEYFHGNSAKEEAHPFRIF 96

  Fly   973 ADIKTF 978
            ..::.|
plant    97 LVVRDF 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:283920
Drf_FH3 253..453 CDD:283917
FH2 608..983 CDD:280362 14/71 (20%)
AT3G25493NP_001326334.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.