DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and dia

DIOPT Version :10

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:XP_061518216.1 Gene:dia / 1279020 VectorBaseID:AGAMI1_005236 Length:1118 Species:Anopheles gambiae


Alignment Length:67 Identity:21/67 - (31%)
Similarity:28/67 - (41%) Gaps:24/67 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 CYFATVT-SLPY-----------------EYAIKFGKLAAKTAI--LITIADDF----FDEKGSF 549
            |.||.|| ::|:                 |.|..|.||...|||  |.|:..::    |.:.|.|
Mosquito    15 CQFAIVTVTVPFYLFLWYFMIKAQFRKFDELATPFFKLCISTAIIDLSTLFANYFGVMFPKFGFF 79

  Fly   550 ND 551
            ||
Mosquito    80 ND 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:461886
Drf_FH3 253..453 CDD:461885
FH2 608..983 CDD:396655
diaXP_061518216.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.