DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dia and LOC101882656

DIOPT Version :9

Sequence 1:NP_001246113.1 Gene:dia / 35340 FlyBaseID:FBgn0011202 Length:1098 Species:Drosophila melanogaster
Sequence 2:XP_005174706.2 Gene:LOC101882656 / 101882656 -ID:- Length:315 Species:Danio rerio


Alignment Length:343 Identity:79/343 - (23%)
Similarity:153/343 - (44%) Gaps:60/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   638 VKCQEDKLAQDDFLAELAVKFSSKPVKKEQKDAVDKP--TTLTKKNVDLRVLDSKTAQNLAIMLG 700
            |.||::|...:               |..:...:.||  .:|.:|:: :::||.|.:|.:.|:: 
Zfish     4 VPCQDEKRNYE---------------KNYEFKGMFKPPGLSLVRKSI-IKLLDGKRSQAVGILI- 51

  Fly   701 GSLKHLSYEQIKICLLRCDTDILSSNILQQLIQYLPPPEHLKRLQ---------EIKAKGEPLPP 756
             |..||..:.|:..:|..|..::....::.|.:....|:.|::::         |:|...:|   
Zfish    52 -SSLHLEMKDIQQAVLTVDHSVVDLETIEALYENRAQPDELEKIKKHYESSKEDELKLLDKP--- 112

  Fly   757 IEQFAATIGEIKRLSPRLHNLNFKLTYADMVQDI--KPDIVAGTAACEEIRNSKKFSKILELILL 819
             |||...:.:|...:.|.|.:.|:..:.|.:..:  |.:|:  :..|:...::.....::.:||.
Zfish   113 -EQFLYELSQIPDFAGRSHCIIFQSVFVDSISSVCRKVEII--STVCKVFLDNDSVKDVIGVILA 174

  Fly   820 LGNYMNSGSKNEA-AFGFEISYLTKLSNTKDADNKQTLL-----HYLADLVEKKFPDALNF---- 874
            .|||||.|::... |.||.:..|.||.:.|..||:.:|:     :||.::.|....|...|    
Zfish   175 FGNYMNGGNRTRGQADGFGLEILPKLKDVKSRDNRMSLVDYVVSYYLRNMDENAGTDKSVFPLPE 239

  Fly   875 YDDLSHVNKASRVNMDAIQKAMR----QMNSAVKNLETDLQNNKVPQCDD--DKFSEVMGKFAEE 933
            ..||.|   |::|..:.:.|.:|    ::.:.||.:|...:|:.    |:  ..|.:.|..|...
Zfish   240 PQDLFH---AAQVKFEDLAKDLRKLKKELTACVKEVEQVCENSS----DEHLQPFKDKMETFIST 297

  Fly   934 CRQQVDVLGKMQLQMEKL 951
            ...|.....||:.:.:.|
Zfish   298 GESQKGCYLKMKCERDML 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
diaNP_001246113.1 Drf_GBD 66..248 CDD:283920
Drf_FH3 253..453 CDD:283917
FH2 608..983 CDD:280362 79/343 (23%)
LOC101882656XP_005174706.2 FH2 32..301 CDD:302999 67/284 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204639at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.