DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhau and AT1G58060

DIOPT Version :10

Sequence 1:NP_610056.1 Gene:Rhau / 35339 FlyBaseID:FBgn0032883 Length:942 Species:Drosophila melanogaster
Sequence 2:NP_176103.2 Gene:AT1G58060 / 842173 AraportID:AT1G58060 Length:1459 Species:Arabidopsis thaliana


Alignment Length:41 Identity:14/41 - (34%)
Similarity:22/41 - (53%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FAGITKESPFS-IGQTLSSSNGVYELGFF---SLNNSQNQY 59
            |.||:|..|.| ..:||:.:.|......|   |:|:|:.:|
plant    11 FFGISKAFPKSQAPRTLAVAIGRKSSRVFFASSVNHSKGRY 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhauNP_610056.1 HrpA 160..>664 CDD:441249
OB_NTP_bind 767..856 CDD:400182
AT1G58060NP_176103.2 DSRM 411..492 CDD:214634
HrpA 612..>1155 CDD:441249
OB_NTP_bind 1290..1387 CDD:400182
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.