DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhau and zcchc17

DIOPT Version :10

Sequence 1:NP_610056.1 Gene:Rhau / 35339 FlyBaseID:FBgn0032883 Length:942 Species:Drosophila melanogaster
Sequence 2:NP_956838.2 Gene:zcchc17 / 393516 ZFINID:ZDB-GENE-040325-2 Length:235 Species:Danio rerio


Alignment Length:46 Identity:13/46 - (28%)
Similarity:22/46 - (47%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 LGKESRVDEIKRRMAR---NMRSDHLMVHNTIIAYRDSRYSHAERD 715
            :|||.:.|::|...:.   |..:...:..|.:||.:|.|.....||
Zfish    75 IGKEMKDDKVKLSFSMKSVNQGTGRDLDPNNVIAEQDERRRRQFRD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhauNP_610056.1 HrpA 160..>664 CDD:441249
OB_NTP_bind 767..856 CDD:400182
zcchc17NP_956838.2 S1_pNO40 16..89 CDD:240191 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.