DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhau and Dhx8

DIOPT Version :10

Sequence 1:NP_610056.1 Gene:Rhau / 35339 FlyBaseID:FBgn0032883 Length:942 Species:Drosophila melanogaster
Sequence 2:NP_659080.2 Gene:Dhx8 / 217207 MGIID:1306823 Length:1244 Species:Mus musculus


Alignment Length:60 Identity:19/60 - (31%)
Similarity:22/60 - (36%) Gaps:16/60 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VVWVANREKPVTDSAA----NLGISSNGS-------LLLSN--GKHGVVWSTGDIFASNG 118
            |.|.|   .||.:.|.    ..|:||||.       :.|||  |..|.......|.|..|
Mouse     4 VSWDA---APVINGAPPTKHQNGLSSNGDAADFEEIIKLSNHSGNSGQSQPADQIMAFEG 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhauNP_610056.1 HrpA 160..>664 CDD:441249
OB_NTP_bind 767..856 CDD:400182
Dhx8NP_659080.2 GH2-like_DHX8 25..92 CDD:409668 12/36 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..289
S1_DHX8_helicase 289..367 CDD:240189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..396
HrpA 580..>1211 CDD:441249
DEAH box 709..712
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.