DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and MTG1

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_013815.1 Gene:MTG1 / 855122 SGDID:S000004703 Length:367 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:46/175 - (26%)
Similarity:72/175 - (41%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 LTTWEQKIREDMRSDQLDILD-EISTAVEGELKISSSIDTTPHEHVKYHSGVLTIG----CIGFP 341
            |..|.:::.|     :..:|| ...|.|...|||   ::...:| ::.:.|.|.:|    ..|.|
Yeast   104 LKNWHEELGE-----KFILLDCRNKTDVRNLLKI---LEWQNYE-LETNGGYLPMGYRALITGMP 159

  Fly   342 NVGKSSLINALK---------GRKVVSVSRT---PGHTKHFQTIFLTPL--------VRLCDCPG 386
            |||||:|||:|:         |||...|::|   .|.|:....:.....        :.|.|.||
Yeast   160 NVGKSTLINSLRTIFHNQVNMGRKFKKVAKTGAEAGVTRATSEVIRVTSRNTESRNEIYLIDTPG 224

  Fly   387 LVFP---SSTPKSLQVLLGSFPISQLAVPYRSLKFLGEHLNLPQL 428
            :..|   |...:.|.:.|.....:.|..|.....:|...:||..|
Yeast   225 IGVPGRVSDHNRMLGLALCGSVKNNLVDPIFQADYLLYLMNLQNL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 36/132 (27%)
GTPase_YlqF 165..474 CDD:274669 46/175 (26%)
MTG1NP_013815.1 RbgA 18..367 CDD:224083 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.