DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and CG17141

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster


Alignment Length:385 Identity:84/385 - (21%)
Similarity:132/385 - (34%) Gaps:127/385 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RQLWRVLEFSDILLIIVDVRYATLMFPPSLYDYIINTLKKHAIVVFNKVDLVEPHAVVAWRQYFR 229
            ||:.:.|...|.::.|.|.|..........:|.|..:..|..|:|.|||||:......:..|..|
  Fly    32 RQIQQKLRNVDCIVEIHDARIPLAGRNSQFFDTITGSGVKPHILVLNKVDLLGAKQQKSVLQQLR 96

  Fly   230 DRYPQLPVVLFASFLPRSRKGSQRGPQAHRRSMEGVYNIYKECQRYVQGEVDLTTWEQKIREDMR 294
            .:.|:|..:||.:                             |                  :|.|
  Fly    97 RQQPELQHILFTN-----------------------------C------------------KDQR 114

  Fly   295 SD-QLDILDEISTAVEGELKISSSID-TTPHEHVKYHSGVLTIGCIGFPNVGKSSLINALKGRKV 357
            :: .|||| .::|.:..|   ||..: |...||        .:..||.|||||||:||.|:...:
  Fly   115 NNGVLDIL-PLATRLVSE---SSRFNRTQAAEH--------NLMIIGVPNVGKSSVINVLRNVHL 167

  Fly   358 -----------VSVSRTPGHTKHFQTIFLTPLVRLCDCPGLVFPSSTPKSLQV---LLGSFPISQ 408
                       ..::|:.|.....|.   .|.|.:.|.||::.||.....:.:   |:|..|.  
  Fly   168 KKKSAARVGAEAGITRSVGERIKIQE---NPPVYMIDTPGILQPSIKDDEMGMKLALVGCLPD-- 227

  Fly   409 LAVPYRSLKFLGEHLNLPQL---LRLHLPEDY-----------DEWSAVAISDAWAYKRGFLTAK 459
                    ..:||.|....|   |..|...||           |:.|||...  :|::....   
  Fly   228 --------HIVGEDLIADYLLYWLNSHRKYDYVEMLKLSSGPSDDISAVLAE--YAHREELF--- 279

  Fly   460 AARPDRYRAANHILRMCLAGQQMLVLQFYPPGFEERREHWLQHPDVGEVKKYQQVELDEP 519
             .:..:|.....::...||..:..:             |:.:...:|      .:.||||
  Fly   280 -HKVKQYDGRVEVMTNLLAAARKFI-------------HFFRSGQLG------HMNLDEP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 57/237 (24%)
GTPase_YlqF 165..474 CDD:274669 76/338 (22%)
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 80/381 (21%)
YlqF 22..206 CDD:206749 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.