DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns4 and CG10914

DIOPT Version :9

Sequence 1:NP_610055.1 Gene:Ns4 / 35338 FlyBaseID:FBgn0032882 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster


Alignment Length:384 Identity:83/384 - (21%)
Similarity:124/384 - (32%) Gaps:136/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RVLEFSDILLIIVDVRYATLMFPPSLYDYIINTL--KKHAIVVFNKVDLVEPHAVVAWRQYFRDR 231
            |:.:...:.:::||:    |.||.|::..:.|.|  |:...:|.|||||: |.....:.|:.:|.
  Fly   173 RIQDKFALAIVLVDL----LDFPCSIWPGMQNILGAKRPVFLVGNKVDLL-PRDSNIYLQHIKDS 232

  Fly   232 YPQLPVVLFASFLPRSRKGSQRGPQAHRRSMEGVYNIYKECQRYVQGEVDLTTWEQKIREDMRSD 296
                   |...|:   :.|...|......|:......|.                          
  Fly   233 -------LQREFI---KHGGGNGLNIKNVSLISAKTGYG-------------------------- 261

  Fly   297 QLDILDEISTAVEGELKISSSIDTTPHEHVKYHSGVLTIGCIGFPNVGKSSLINALKGRKVVSVS 361
                ::|:.|.:              |:...|...|..:||   .|||||||.|.|         
  Fly   262 ----IEELITQL--------------HKTWAYKGDVYLVGC---TNVGKSSLFNIL--------- 296

  Fly   362 RTPGHTKHFQTIFLTP----LVR-LCDCPGLVFPSSTPKSLQVLLGSFPI---SQLAVPYRSLKF 418
                    ..:.:..|    ||| ...||   :|.:|.|.|:     |||   |...|..|..:.
  Fly   297 --------LNSDYCRPEASDLVRKATTCP---WPGTTLKLLR-----FPILRPSNDRVYQRFKRL 345

  Fly   419 LGEHLNLPQLLRLHLPEDYDEWSAVAISDAWAYKRGFLTAKAARP--------DRYRAANHILRM 475
            :.|        |....|...|..|||        |...:|.||:|        ||....:....|
  Fly   346 VSE--------RSEKAEMEKERRAVA--------RETGSAAAAQPVAPVGRTFDRRENLHDAFAM 394

  Fly   476 CLAGQQMLVLQFYPPGFEERREHW------LQHPD-------VGEVKKYQQVELDEPES 521
              ||....:......|.|.:...|      :..||       ..|:.|.|...:..|.:
  Fly   395 --AGGSRPITTLNDRGKEYKEARWVYDTPGVMQPDQISPLLTAEELVKLQPATMIRPRA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns4NP_610055.1 HSR1_MMR1 163..390 CDD:206750 47/227 (21%)
GTPase_YlqF 165..474 CDD:274669 71/322 (22%)
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 83/384 (22%)
YqeH 145..332 CDD:206748 54/245 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.